Santa Fun Kindergarten Games APK
Version 3.08c - co.familyplay.santakindergartenfreefamilyplay,santakindergartenfree,educational,santa's,kindergarten,game
Santa is inviting all kids to have an exciting season of kindergarten learning!
APP Information
Download Version | 3.08c (308) |
Apk Size | 34.87 MB |
App Developer | Sam Witteveen |
Malware Check | TRUSTED |
Install on Android | 4.1.x and up |
App Package | co.familyplay.santakindergartenfree.apk |
MD5 | c9713a0de805cf5f4201caafcc96ed38 |
Rate | 5 |
Website | http://familyplay.co |
Table of Contents
Download Santa Fun Kindergarten Games 3.08c APK
App Description
Santa Fun Kindergarten Games is familyplay,santakindergartenfree,educational,santa's,kindergarten,game, content rating is Everyone (PEGI-3). This app is rated 5 by 1 users who are using this app. To know more about the company/developer, visit Sam Witteveen website who developed it. co.familyplay.santakindergartenfree.apk apps can be downloaded and installed on Android 4.1.x and higher Android devices. The Latest Version of 3.08c Available for download. Download the app using your favorite browser and click Install to install the application. Please note that we provide both basic and pure APK files and faster download speeds than APK Mirror. This app APK has been downloaded 2579+ times on store. You can also download co.familyplay.santakindergartenfree APK and run it with the popular Android Emulators.
Hohoho!! Happy holidays from Santa! He is inviting all good children to have an exciting season of kindergarten learning! This fun adventure game of early childhood developmental activities contains 12 kindergarten learning games that is perfect for kids aged 5 and up. Santa Fun Kindergarten Games teaches the basics of kindergarten learning – a little more advanced from the pre-school activities. These fun and exciting exercises involve pattern recognition and sequences, basic spelling, matching of objects, colors, shapes and animals to their correct names and a variety of challenging mathematical concepts designed to develop early childhood literacy. Come and join jolly Santa and have lots of fun learning this season. Woo hoo! How exciting! Featuring a brilliantly-colored Santa to motivate the kids and includes positive encouragement, professional narration and playful music. This app includes a variety of common core kindergarten skills: NUMBER IDENTIFICATION KINDERGARTEN MATH Identify numbers from a random series Identify which one is the smallest number Identify which one is the biggest number Identify the missing numbers in a sequence Identify which set has the most or least number MATCHING SANTA GAME Draw a line to match the shapes to its name Draw a line to match the colors to its names Draw a line to match the numbers to its names Draw a line to match the objects to its names Draw a line to match the animals to its names COMPARISON Compare more or less SPELLING Find the first letter of the word Spell the word by arranging the letters in the right order PATTERNS What comes next in the pattern? This interactive and engaging kids free Santa games for children of word play develops advanced critical thinking for kindergarten kids, an educational app for kinder kids that features a jolly santa on spelling tests, missing numbers, matching games, a variety of exercises on numbers and patterns. It’s a nonstop game play for you and your own holiday rush of exciting learning. For the parents: 1. Does not contain links to social networking sites or to the internet that are not protected by a parent lock. 2. Contains a limited amount of free content with an in-app purchase to unlock all games. For the parents, do join our community and tell us what you think or send us your comments and feedback. We truly appreciate anything you can give us. Like our Facebook Page, http://www.facebook.com/FamilyPlayApps, and get the latest updates, contests and some freebies. You can also follow us on Twitter, @FamilyPlayApps, to get the latest news and new apps from Family Play. No Sound? If the sound is not working, make sure the mute is turned off, then turn up the volume and the sound will work. Need Help? Contact us with any questions or comments: [email protected] We Value Your Feedback We always welcome your feedback, comments and suggestions. You can contact us at [email protected] If you do like our app, please take a minute to rate and write a great review.
App ChangeLog
App Screens
co-familyplay-santakindergartenfree-308-50832296-c9713a0de805cf5f4201caafcc96ed38.apkApk scan results
Apk Scaned By TotalVirus Antivirus,co.familyplay.santakindergartenfree.apk Was Risky.Detected 1 From 55 Scan. Scan Stats:harmless:0|type-unsupported:9|suspicious:0|confirmed-timeout:0|timeout:5|failure:1|malicious:0|undetected:56| Name:co-familyplay-santakindergartenfree-308-50832296-c9713a0de805cf5f4201caafcc96ed38.apk SHA-1:a09ae2d6bfbb55c826929167c0c56eac181a3c95 SHA-256:b7c1ec0e80f3f0839a83150535c3a42d220105c4a28a6a48859d944d3fab18b3 SSDEEP:786432:qBE6hrNpu02uxaYpECYerEBvf1I7+7pcPKfxjhDfVQ1ME+KUNRZ9KalkaX:Y5puRyLdRFy7QO5h5TE+PzDKabX File type:Android Magic:Zip archive data, at least v2.0 to extract File size:36562106 Uncompressed Size:166448037 Contained Files :683 Contained Files By Type:xml:85,dex:1,MF:1,map:3,RSA:1,dat:2,so:5,ini:1,SF:1,png:29,