Ballerina Kindergarten Games APK
Version 3.15c - co.familyplay.ballerinakindergartenfreefamilyplay,ballerinakindergartenfree,educational,ballerina,kindergarten,games
APP Information
Download Version | 3.15c (315) |
Apk Size | 46.76 MB |
App Developer | Sam Witteveen |
Malware Check | TRUSTED |
Install on Android | 4.1.x and up |
App Package | co.familyplay.ballerinakindergartenfree.apk |
MD5 | d0fcd45e156d8ab5230517cd4d931b2e |
Rate | 5 |
Website | http://familyplay.co |
Table of Contents
Download Ballerina Kindergarten Games 3.15c APK
App Description
Ballerina Kindergarten Games is familyplay,ballerinakindergartenfree,educational,ballerina,kindergarten,games, content rating is Everyone (PEGI-3). This app is rated 5 by 1 users who are using this app. To know more about the company/developer, visit Sam Witteveen website who developed it. co.familyplay.ballerinakindergartenfree.apk apps can be downloaded and installed on Android 4.1.x and higher Android devices. The Latest Version of 3.15c Available for download. Download the app using your favorite browser and click Install to install the application. Please note that we provide both basic and pure APK files and faster download speeds than APK Mirror. This app APK has been downloaded 3645+ times on store. You can also download co.familyplay.ballerinakindergartenfree APK and run it with the popular Android Emulators.
This dance class adventure of early childhood developmental activities contains 12 kindergarten learning games is perfect for kids aged 5 and up. Ballerina Kindergarten Games teaches the basics of kindergarten learning – a step higher and a little more advanced from the pre-school activities. These fun and exciting exercises involve pattern recognition and sequences, basic spelling, matching of objects, colors, shapes and animals to their correct names and a variety of challenging mathematical concepts designed to develop early childhood literacy. Be the first to have a fun learning encounter with the ballerina dancers in an enchanting performance and learn together on a magical journey. Woo hoo! How exciting! Let your adorable little star dancer realize her ballerina dream through the game’s positive encouragement that features professional narration and playful music. This app includes a variety of common core kindergarten skills: NUMBER IDENTIFICATION KINDERGARTEN MATH Identify numbers from a random series Identify which one is the smallest number Identify which one is the biggest number Identify the missing numbers in a sequence Identify which set has the most or least number MATCHING BALLERINA PRINCESS GAME Draw a line to match the shapes to its name Draw a line to match the colors to its names Draw a line to match the numbers to its names Draw a line to match the objects to its names Draw a line to match the animals to its names COMPARISON Compare more or less SPELLING Find the first letter of the word Spell the word by arranging the letters in the right order PATTERNS What comes next in the pattern? This interactive and engaging games of word play improve math skills and develop advanced critical thinking for kindergarten kids. It’s a nonstop game play for your very own ballerinas guaranteed for a fantastic learning. For the parents, do join our community and tell us what you think or your comments and feedback. We truly appreciate anything you can give us. Like our Facebook Page, http://www.facebook.com/FamilyPlayApps, and get the latest updates, contests and some freebies. You can also follow us on Twitter, @FamilyPlayApps, to get the latest news and new apps from Family Play. No Sound? If the sound is not working, make sure the mute is turned off, then turn up the volume and the sound will work. Need Help? Contact us with any questions or comments: [email protected] We Value Your Feedback We always welcome your feedback, comments and suggestions. You can contact us at [email protected] If you do like our app, please take a minute to rate and write a great review.
App ChangeLog
- Santa's helpers are in town to help us fix the app!
App Screens
d0fcd45e156d8ab5230517cd4d931b2e.virusApk scan results
Apk Scaned By TotalVirus Antivirus,co.familyplay.ballerinakindergartenfree.apk Was Risky.Detected 2 From 55 Scan. Scan Stats:harmless:0|type-unsupported:12|suspicious:0|confirmed-timeout:0|timeout:0|failure:2|malicious:0|undetected:63| Name:d0fcd45e156d8ab5230517cd4d931b2e.virus SHA-1:d71fb410f14ccafd5e448d290a2ee5dc70555776 SHA-256:1eacf3cf234cecdf39701f5b4124c3780b8f9edf54d7dcb145d91e90c6cc4abd SSDEEP:786432:MeDuxGx8ULSiY669tdWu/p3Km8XvPsq9E:5YHew60dDp8fP79E File type:Android Magic:Zip archive data, at least v2.0 to extract File size:49027913 Uncompressed Size:124667959 Contained Files :688 Contained Files By Type:xml:57,dex:1,MF:1,map:3,RSA:1,dat:2,so:5,ini:1,SF:1,png:77,
Renu Thakur
I loved this game very very much. I have 5 stars to this game. Please installed this game.
Eeman Azam
BAD👅👅👅👅