Kids Preschool Learning Games APK
Version 3.15c - co.familyplay.monsterkindergartenfreefamilyplay,monsterkindergartenfree,educational,kids,preschool,learning,games
APP Information
Download Version | 3.15c (315) |
Apk Size | 49.37 MB |
App Developer | Sam Witteveen |
Malware Check | TRUSTED |
Install on Android | 4.1.x and up |
App Package | co.familyplay.monsterkindergartenfree.apk |
MD5 | 52a8b6c2b5e64d47380c062c3ebb694d |
Rate | 5 |
Website | http://familyplay.co |
Table of Contents
Download Kids Preschool Learning Games 3.15c APK
App Description
Kids Preschool Learning Games is familyplay,monsterkindergartenfree,educational,kids,preschool,learning,games, content rating is Everyone (PEGI-3). This app is rated 5 by 1 users who are using this app. To know more about the company/developer, visit Sam Witteveen website who developed it. co.familyplay.monsterkindergartenfree.apk apps can be downloaded and installed on Android 4.1.x and higher Android devices. The Latest Version of 3.15c Available for download. Download the app using your favorite browser and click Install to install the application. Please note that we provide both basic and pure APK files and faster download speeds than APK Mirror. This app APK has been downloaded 1387+ times on store. You can also download co.familyplay.monsterkindergartenfree APK and run it with the popular Android Emulators.
Ever heard of cute monsters? Discover them in a unique kindergarten learning with your monster friends! This kid monster game of early childhood developmental activities contains 12 kindergarten learning games that are perfect for kids aged 5 and up. Monster Kindergarten Fun Games is a preschool and kindergarten app that teaches the basics of kindergarten learning – a little more advanced from the pre-school activities. These fun and exciting exercises involve pattern recognition and sequences, basic spelling for kindergarten, matching of objects, colors, shapes and animals to their correct names and a variety of challenging mathematical concepts like addition for kindergarten, add and subtract game, designed to develop early childhood literacy. Join in on the most fun learning encounter with the coolest monster and learn together on an awesome preschool and kindergarten adventure. Woohoo! How exciting! Featuring a delightful monster buddy, let him motivate your kids with positive encouragement that features professional narration and playful music. This app includes a variety of common core kindergarten skills: NUMBER IDENTIFICATION KINDERGARTEN MATH Identify numbers from a random series Identify which one is the smallest number Identify which one is the biggest number Identify the missing numbers in a sequence Identify which set has the most or least number MATCHING KID MONSTER GAME Draw a line to match the shapes to their names Draw a line to match the colors to their names Draw a line to match the numbers to their names Draw a line to match the objects to their names Draw a line to match the animals to their names COMPARISON Compare more or less KINDERGARTEN SPELLING Find the first letter of the word Spell the word by arranging the letters in the right order KINDERGARTEN PATTERNS What comes next in the pattern? This interactive and engaging kid monster game of word play develops advanced critical thinking for kindergarten kids, an educational app for kinder kids that features an adorable monster buddy on spelling tests, missing numbers, matching games, and a variety of exercises on numbers and patterns. It’s a nonstop game play for you and your own monster pal for a fantastic learning. Features: - Clear and precise pronunciation of words - High quality graphics, kid-friendly interface and fun educational kindergarten games - Adorable character that will cheer on and guide all throughout the game play - Reinforces correct learning with animation for correct answers and gentle redirection for incorrect ones - All in one educational games for kindergarten For the parents, do join our community and tell us what you think or send us your comments and feedback. We truly appreciate anything you can give us. Like our Facebook Page, http://www.facebook.com/FamilyPlayApps, and get the latest updates, contests and some freebies. You can also follow us on Twitter, @FamilyPlayApps, to get the latest news and new apps from Family Play. No Sound? If the sound is not working, make sure the mute is turned off, then turn up the volume and the sound will work. Need Help? Contact us with any questions or comments: [email protected] We Value Your Feedback We always welcome your feedback, comments and suggestions. You can contact us at [email protected] If you do like our app, please take a minute to rate and write a great review.
App ChangeLog
- Santa's helpers are in town to help us fix the app!