Deep Time Walk: Earth history APK
Version 1.3.0 - air.org.deeptimewalk.deeptimewalkfsdeeptimewalk,deeptimewalkfs,education
Experience a new story of the living Earth.
![Deep Time Walk: Earth history apk Deep Time Walk: Earth history apk](https://i2.wp.com/img.aapks.com/imgs/a/5/e/a5ecd5924f37f0226a57dbc14c5b0b46.png?w=705)
APP Information
Download Version | 1.3.0 (2012000) |
Apk Size | 94.42 MB |
App Developer | Deep Time Walk C.I.C. |
Malware Check | TRUSTED |
Install on Android | 4.0.x and up |
App Package | air.org.deeptimewalk.deeptimewalkfs.apk |
MD5 | 3c1ea26a751e1e78d4b180ee4fc7dc0c |
Rate | 5 |
Website | http://www.deeptimewalk.org |
Table of Contents
Download Deep Time Walk: Earth history 1.3.0 APK
App Description
Deep Time Walk: Earth history is deeptimewalk,deeptimewalkfs,education, content rating is Everyone (PEGI-3). This app is rated 5 by 1 users who are using this app. To know more about the company/developer, visit Deep Time Walk C.I.C. website who developed it. air.org.deeptimewalk.deeptimewalkfs.apk apps can be downloaded and installed on Android 4.0.x and higher Android devices. The Latest Version of 1.3.0 Available for download. Download the app using your favorite browser and click Install to install the application. Please note that we provide both basic and pure APK files and faster download speeds than APK Mirror. This app APK has been downloaded 8+ times on store. You can also download air.org.deeptimewalk.deeptimewalkfs APK and run it with the popular Android Emulators.
Step back in time and experience Earth history like never before. The award-winning Deep Time Walk is a ground-breaking tool enabling anyone, anywhere to take a walking audio history of our planet. • Walk 4.6km through 4.6 billion years of deep time, each metre = 1 million years. • Learn about key concepts from Earth’s long evolution including how Earth formed, the evolution of life, plate tectonics, oxygenic photosynthesis, multicellular life, The Cambrian Explosion, vertebrates, plants, amphibians, mammals, dinosaurs and finally (in the last 20cm) humans. • Understand our species common ancestral heritage and interconnectedness with all life. • Comprehend the ecological impact of humans in the blink of a geological eye. • Time-contextual glossary available to review key scientific concepts. • Mobility-assist mode available for those unable to walk. • What's Next portal for positive action (with organisations such as Earth Charter and 350.org). The dramatised audio is directed by Jeremy Mortimer (over 200 productions for BBC Radio) and designed by Jo Langton (a BBC Studio Manager), with voices provided by leading actors Paul Hilton (Garrow’s Law, The Bill, Silent Witness), Chipo Chung (Doctor Who, Sherlock, Into the Badlands) and Peter Marinker (Love Actually, Event Horizon, Judge Dredd). The script is written by Peter Oswald (ex-playwright in residence at Shakespeare Globe, London) and Dr Stephan Harding. Produced by Deep Time Walk CIC, a not-for-profit social enterprise based in the UK. ** Platinum Award Winner of Best Mobile App Summer Awards - Best Designed Mobile App Interface **
App ChangeLog
- - New extended introductory sequence
- - Expanded screens support
- - Links to the new, tactile, Deep Time Cards