Fun Snowman Kindergarten Games APK
Version 3.05c - co.familyplay.snowmankindergartenfreefamilyplay,snowmankindergartenfree,educational,snowman,kindergarten
APP Information
Download Version | 3.05c (305) |
Apk Size | 32.56 MB |
App Developer | Sam Witteveen |
Malware Check | TRUSTED |
Install on Android | 4.1.x and up |
App Package | co.familyplay.snowmankindergartenfree.apk |
MD5 | 2568e3c8826c59a2a98aef588ac23010 |
Rate | 5 |
Website | http://familyplay.co |
Table of Contents
Download Fun Snowman Kindergarten Games 3.05c APK
Get Your Little Ones Excited with These Fun Snowman Kindergarten Games on Android!
1. Frosty's Snowball Toss:
Step right up and join the snowball-throwing extravaganza! In this delightful game, children can test their aim and coordination by tossing snowballs at different targets. Help Frosty hit the bullseye and watch as their eyes light up with joy!2. Snowman Puzzle Time:
Calling all puzzle enthusiasts! Engage your young learners with a captivating snowman puzzle adventure. As they piece together the different parts of a snowman, they'll develop problem-solving skills, hand-eye coordination, and a love for brain-teasing challenges that will keep them entertained for hours.3. Snowman Dress-Up Bonanza:
Let your little fashionistas have a blast with this awesome dress-up game! Give their creative minds the opportunity to mix and match various winter-themed outfits to dress their virtual snowman. From colorful scarves to stylish hats, watch as their imagination runs wild and they create the trendiest snowman in town!4. Snowman Building Contest:
It's time to put those building skills to the test! Challenge your little engineers in a snowman-building contest where they can unleash their creativity and construct the most impressive snowman. With different accessories and decorations to choose from, this game guarantees endless fun and friendly competition.5. Snowball Run:
Get ready for an exhilarating race downhill with our beloved snowman friends! Help them dodge obstacles, collect power-ups, and beat their competitors to the finish line. With exciting twists and turns, this game will keep your kindergartners on the edge of their seats, begging for just one more run.Unleash the Winter Wonderland Fun on Your Android Device!
With these exciting snowman-themed games, your kindergartners will be captivated by the magical world of snow and winter. Not only will they have a blast, but they'll also develop essential skills such as hand-eye coordination, problem-solving, and creativity. Don't miss out on the opportunity to make learning fun and memorable. Download these Android games now and let the snowballing adventures begin!App Description
Fun Snowman Kindergarten Games is familyplay,snowmankindergartenfree,educational,snowman,kindergarten, content rating is Everyone (PEGI-3). This app is rated 5 by 1 users who are using this app. To know more about the company/developer, visit Sam Witteveen website who developed it. co.familyplay.snowmankindergartenfree.apk apps can be downloaded and installed on Android 4.1.x and higher Android devices. The Latest Version of 3.05c Available for download. Download the app using your favorite browser and click Install to install the application. Please note that we provide both basic and pure APK files and faster download speeds than APK Mirror. This app APK has been downloaded 2186+ times on store. You can also download co.familyplay.snowmankindergartenfree APK and run it with the popular Android Emulators.
Be a jolly little fellow with the cutest snowman this holiday season of kindergarten learning! This fun adventure game of early childhood developmental activities contains 12 kindergarten learning games that is perfect for kids aged 5 and up. Fun Snowman Kindergarten Games teaches the basics of kindergarten learning – a little more advanced from the pre-school activities. These fun and exciting exercises involve pattern recognition and sequences, basic spelling, matching of objects, colors, shapes and animals to their correct names and a variety of challenging mathematical concepts designed to develop early childhood literacy. Build a snowman and have lots of fun learning this season. Woo hoo! How exciting! Featuring a brilliantly-colored snowman to motivate the kids and includes positive encouragement, professional narration and playful music. This app includes a variety of common core kindergarten skills: NUMBER IDENTIFICATION KINDERGARTEN MATH Identify numbers from a random series Identify which one is the smallest number Identify which one is the biggest number Identify the missing numbers in a sequence Identify which set has the most or least number MATCHING FUN SNOWMAN GAME Draw a line to match the shapes to its name Draw a line to match the colors to its names Draw a line to match the numbers to its names Draw a line to match the objects to its names Draw a line to match the animals to its names COMPARISON Compare more or less SPELLING Find the first letter of the word Spell the word by arranging the letters in the right order PATTERNS What comes next in the pattern? This interactive and engaging kids snowman kids games of word play develops advanced critical thinking for kindergarten kids, an educational app for kinder kids that features a jolly snowman on spelling tests, missing numbers, matching games, a variety of exercises on numbers and patterns. It’s a nonstop game play for you and your own holiday rush of exciting learning. For the parents, do join our community and tell us what you think or send us your comments and feedback. We truly appreciate anything you can give us. Like our Facebook Page, http:www.facebook.comFamilyPlayApps, and get the latest updates, contests and some freebies. You can also follow us on Twitter, @FamilyPlayApps, to get the latest news and new apps from Family Play. No Sound? If the sound is not working, make sure the mute is turned off, then turn up the volume and the sound will work. Need Help? Contact us with any questions or comments: [email protected] We Value Your Feedback We always welcome your feedback, comments and suggestions. You can contact us at [email protected] If you do like our app, please take a minute to rate and write a great review.
App ChangeLog
App Screens
co-familyplay-snowmankindergartenfree-305-47606706-2568e3c8826c59a2a98aef588ac23010.apkApk scan results
Apk Scaned By TotalVirus Antivirus,co.familyplay.snowmankindergartenfree.apk Was Risky.Detected 1 From 55 Scan. Scan Stats:harmless:0|type-unsupported:11|suspicious:0|confirmed-timeout:0|timeout:7|failure:1|malicious:0|undetected:55| Name:co-familyplay-snowmankindergartenfree-305-47606706-2568e3c8826c59a2a98aef588ac23010.apk SHA-1:cb363460bf20d540c55047b253359423c197a642 SHA-256:8bcc7cb0556acf38404ba479466a14c8d1c15755898ecafe44a70a576b53eb83 SSDEEP:786432:/3X5qgf+R0QvM6YcS3kBSwFZY+0MEdKPV9Ka+WV349eK3iUAK95:/55+9NSOrrEd4vKa+U3453ine File type:Android Magic:Zip archive data, at least v2.0 to extract File size:34140080 Uncompressed Size:140581634 Contained Files :643 Contained Files By Type:dex:1,xml:46,MF:1,map:3,RSA:1,dat:2,so:3,ini:1,SF:1,png:41,
Omar Sameh
ذغتاتاعا