Mermaid Princess Pre K Games APK
Version 3.15c - co.familyplay.mermaidkindergartenfreefamilyplay,mermaidkindergartenfree,educational,mermaid,princess,games

APP Information
Download Version | 3.15c (315) |
Apk Size | 48.83 MB |
App Developer | Family Play ltd |
Malware Check | TRUSTED |
Install on Android | 4.1.x and up |
App Package | co.familyplay.mermaidkindergartenfree.apk |
MD5 | b97d3e031c17f4bc88590a805ba550f7 |
Rate | 5 |
Website | http://familyplay.co |
Table of Contents
Download Mermaid Princess Pre K Games 3.15c APK
Mermaid Princess Pre K Games Android App
The Mermaid Princess Pre K Games Android app is a delightful way to help young children get ready to start learning. This colorful and engaging app helps children practice their counting skills, shapes and colors, and more as they explore fun scenes from the underwater world. Developed by experts in early childhood education and with feedback from parents, this app will turn learning into a fun and playful experience for kids aged 2-6.
The app includes 12 different games structured differently in two levels of difficulty. Examples of the games available in the app includes finding numbers from 1 to 10, learning to sort shapes, matching colors, and playing the memory game. Every game includes different characters in colorful and charming illustration that helps children to build their visual ability, problem-solving skills, and hand-eye coordination.
Mermaid Princess Pre K Games was developed by experts in early childhood development and has been carefully designed to help children learn while having fun. With its colorful illustrations, sounds, and animation as well as varying levels of difficulties, this app offers an interactive experience that appeals to a wide range of ages. As children progress, they can unlock new parts of the underwater world, revealing different characters, plants, and animals.
The developers take the safety of the users seriously and has made the app available on a secure platform with no in-app purchases or advertising. The data collected is not used for any purpose and will in no way be shared with third-party merchants.
The Mermaid Princess Pre K Games Android app is a great way to help introduce young children to the world of numbers, shapes, and colors while having fun. With its beautiful graphics, pleasant sounds and varying levels of difficulty, this app is sure to provide a great learning experience for children aged 2-6.
Keywords: mermaid princess pre k , android app , kids game , learning games , early education , counting skills , shapes and colors , interactive experience
App Description
Mermaid Princess Pre K Games is familyplay,mermaidkindergartenfree,educational,mermaid,princess,games, content rating is Everyone (PEGI-3). This app is rated 5 by 1 users who are using this app. To know more about the company/developer, visit Family Play ltd website who developed it. co.familyplay.mermaidkindergartenfree.apk apps can be downloaded and installed on Android 4.1.x and higher Android devices. The Latest Version of 3.15c Available for download. Download the app using your favorite browser and click Install to install the application. Please note that we provide both basic and pure APK files and faster download speeds than APK Mirror. This app APK has been downloaded 2347+ times on store. You can also download co.familyplay.mermaidkindergartenfree APK and run it with the popular Android Emulators.
Dive deep into the ocean kingdom with the mermaid princess for an awesome kids kindergarten learning. This mermaid adventure of early childhood developmental activities contains 12 kindergarten learning games is perfect for kids aged 5 and up. Mermaid Princess Fun Kindergarten Learning Games at the Kingdom teaches the basics of kindergarten learning – a step higher and a little more advanced from the pre-school activities. These fun and exciting exercises involve pattern recognition and sequences, basic spelling, matching of objects, colors, shapes and animals to their correct names and a variety of challenging mathematical concepts designed to develop early childhood literacy. Be the first to have a fun learning encounter with the mermaid princess magical world and learn together on a magical journey. Woo hoo! How exciting! Featuring, a magical mermaid kingdom, let the adorable mermaid princess motivate your kids with positive encouragement that features professional narration and playful music. This app includes a variety of common core kindergarten skills: NUMBER IDENTIFICATION KINDERGARTEN MATH Identify numbers from a random series Identify which one is the smallest number Identify which one is the biggest number Identify the missing numbers in a sequence Identify which set has the most or least number MATCHING MERMAID PRINCESS GAME Draw a line to match the shapes to its name Draw a line to match the colors to its names Draw a line to match the numbers to its names Draw a line to match the objects to its names Draw a line to match the animals to its names COMPARISON Compare more or less SPELLING Find the first letter of the word Spell the word by arranging the letters in the right order PATTERNS What comes next in the pattern? This interactive and engaging kids mermaid free game of word play develops advanced critical thinking for kindergarten kids, an educational app for kinder kids that features a mermaid adventure on spelling tests, missing numbers, matching games, a variety of exercises on numbers and patterns. It’s a nonstop game play for your very own mermaids for a fantastic learning. For the parents, do join our community and tell us what you think or your comments and feedback. We truly appreciate anything you can give us. Like our Facebook Page, http://www.facebook.com/FamilyPlayApps, and get the latest updates, contests and some freebies. You can also follow us on Twitter, @FamilyPlayApps, to get the latest news and new apps from Family Play. No Sound? If the sound is not working, make sure the mute is turned off, then turn up the volume and the sound will work. Need Help? Contact us with any questions or comments: [email protected] We Value Your Feedback We always welcome your feedback, comments and suggestions. You can contact us at [email protected] If you do like our app, please take a minute to rate and write a great review.
App ChangeLog
- Santa's helpers are in town to help us fix the app!
A Google user
Red