3D Shark Live Wallpaper APK
Version 1.1 - com.freewps.threedsharklivewallpaperfreewps,threedsharklivewallpaper,personalization,shark,live,wallpaper
APP Information
Download Version | 1.1 (2) |
Apk Size | 3.63 MB |
App Developer | Free Wallpapers and Backgrounds |
Malware Check | TRUSTED |
Install on Android | 4.1.x and up |
App Package | com.freewps.threedsharklivewallpaper.apk |
MD5 | 53ea38ba2cc68435dc0a93e1eef3640c |
Rate | 5 |
Website | http://free-wlps.com |
Table of Contents
Download 3D Shark Live Wallpaper 1.1 APK
App Description
3D Shark Live Wallpaper is freewps,threedsharklivewallpaper,personalization,shark,live,wallpaper, content rating is Everyone (PEGI-3). This app is rated 5 by 1 users who are using this app. To know more about the company/developer, visit Free Wallpapers and Backgrounds website who developed it. com.freewps.threedsharklivewallpaper.apk apps can be downloaded and installed on Android 4.1.x and higher Android devices. The Latest Version of 1.1 Available for download. Download the app using your favorite browser and click Install to install the application. Please note that we provide both basic and pure APK files and faster download speeds than APK Mirror. This app APK has been downloaded 344+ times on store. You can also download com.freewps.threedsharklivewallpaper APK and run it with the popular Android Emulators.
Ready for the “shark attack”? 3D Shark Live Wallpaper is finally here! We have prepared the craziest collection of dangerous “shark wallpapers”! Bring the “shark world” on your phone screen and don't be afraid of the shark bite! Everything is ready for the “shark mania” to begin! All you have to do is to “free download” these live wallpapers hd of beautiful sharks! These are the best “wild animal wallpapers” that you can find! So, if you adore these dangerous creatures with sharp teeth, you will like this “sharks live wallpaper”. Just one look at this “hungry shark” will make the fear run cold through your vains. Now you can free “swim with sharks” without entering the cage. Get the best “pics of sharks” and enjoy the deep blue ocean pictures. Choose among many sharks wallpapers of all shark types. White shark pictures, tiger sharks, zebra shark, shark whale or hammered shark are one click away from you! Download this fish wallpaper for free and provide yourself your favorite animal pictures! - Wide choice of phenomenal live wallpapers! - Excellent 3D parallax effect! - Beautiful HD graphics and open GL! - Animated objects falling down the screen! - Choose the speed, number and type of particles! - Social share button! - Optimized battery usage! - Compatible with 99% mobile phones and tablet devices! - The 3d shark wallpaper app will sleep when your phone is inactive, so this 3d "shark live wallpaper" will not drain your battery! - 3d shark backgrounds fully support horizontal orientation and look amazing on both mobile phones and tablet devices! - New wallpapers are added daily – collect all of them! - This beautiful, free and enjoyable background is waiting for you! Meet all kinds of sharks by downloading the best 3D Shark Live Wallpaper! Feel excitement when you find yourself face to face with “shark images”. Make your phone fierce with “sea dog wallpapers”! If you love these “sea predators”, this wallpaper app is a must have for you! Get for free moving wallpapers of sharks and explore the sea world. Decorate your home screen with the small exotic fish swimming around the “big shark”! Customize your mobile with the “shark reef live wallpaper free”! You will enjoy the underwater oceanic world with the shark dynamic desktop wallpaper! Catch the shark and keep her on your phone background. “3D sharks live wallpaper lite” will make you feel part of this “under the sea” world. Searching for the perfect “ocean live wallpaper”? But with the fish pictures like shark? You are at the right place! “3d shark live wallpapers” will make you go crazy. If you like to watch the shark videos, just install this perfect "3D sharks live wallpaper HD" app, the beautiful fishes, colorful sea corals and plants will dress up your phone screen with gorgeous backgrounds and smooth motion. Turn your phone into a mini aquarium with shark aquarium wallpapers! Its cool 3D parallax effect will make you feel that you are visiting a real “shark pool”. The 3D Shark Live Wallpaper is waiting for you! Scary shark wallpaper will make you a fishdom loner if you set it now. If you are not afraid of these sea dogs, let this live wallpaper hd be your prey. Get the white shark photo and set it very easy. Angry sharks images will make your display dangerously beautiful. Embellish your phone with “big sharks” images hd! Catching sharks is not easy, but you can have your sharks whenever you want! Enter the world of sharks by setting these ocean pictures with scary fish! Shark LWP is finally at your disposal! DISCLAIMER: This app contains images for which are believed to be in public domain. Please notify us immediately if you own rights and it will be removed!
App ChangeLog
- Minor bugs fixed and performance improved!
Dqrqk
I didn't like this and the shark wasn't live, It was just a bunch of fish moving backwards this is fake
ibrahimisa alkali
Just a scam, it's no more than a standstill object. Don't download it.
Supa Sii
i don't like ads randomly coming up bad!
Mallikarjun Reddy
Very nice wallpapers but most cannot be kept on your screen
Joseph Mensah
My phone does not support the live wallpapers
Edith Cortes
Very dumb there is only 1 wallpaper and the game said there was more do not download this people
Dead sxngz
The shark doesn't even move honestly pointless
Md Jakir
This is a very good live wallpaper app
Claire sporty
Terrible was not a shark 3d just a pic of a shark with fish swimming by
Amaya Iduwari
this aap is not good i don't like this aap this is west of time this aap is fake